PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr4P05090_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family bZIP
Protein Properties Length: 172aa    MW: 19080.5 Da    PI: 8.9584
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr4P05090_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_149.78.1e-1699149454
                            XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                 bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 
                            ++r +r++kNRe+A rsR+RK+a++ eLe+ v+ L  eN+ Lk + eelk 
  GSMUA_Achr4P05090_001  99 DRRKKRMIKNRESAARSRARKQAYTIELEQAVDHLLYENRFLKRQCEELKR 149
                            689*************************************99999999986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.5E-1396160IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1709.5E-1696150No hitNo description
PROSITE profilePS5021710.66898149IPR004827Basic-leucine zipper domain
PfamPF001702.3E-13100149IPR004827Basic-leucine zipper domain
CDDcd147078.02E-26100154No hitNo description
SuperFamilySSF579592.0E-12100151No hitNo description
PROSITE patternPS000360103118IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 172 aa     Download sequence    Send to blast
MEQVWQDISL SSSLREEDVP STPSPSLYGA STAAASCSFG GNLKETSDRI LPAPLSLSFG  60
CLDSSIDGVG SGSVVDWCPK KHAMEQRWNG SFSSGTDVDR RKKRMIKNRE SAARSRARKQ  120
AYTIELEQAV DHLLYENRFL KRQCEELKRA TVHQLPVATK SSTLQRTLTA PF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009395383.11e-126PREDICTED: bZIP transcription factor TRAB1-like isoform X2
TrEMBLM0SL761e-126M0SL76_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr4P05090_0011e-125(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP97643044
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35900.14e-22bZIP family protein